SCOP 1.63: Domain d1cgu_3: 1cgu 407-494

Lineage for d1cgu_3 (1cgu 407-494)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries)

8. Domain d1cgu_3: 1cgu 407-494 [27745]
   Other proteins in same PDB: d1cgu_1, d1cgu_2, d1cgu_4
   complexed with ca, glc; mutant

Details for d1cgu_3

PDB Entry: 1cgu, 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x- ray structure analysis combined with site-directed mutagenesis

SCOP Domain Sequences for d1cgu_3:

Sequence; same for both SEQRES and ATOM records:

>d1cgu_3 b.71.1.1 (407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta

Timeline for d1cgu_3:

• d1cgu_3 first appeared (with stable ids) in SCOP 1.55
  
• d1cgu_3 appears in SCOP 1.61
  
• d1cgu_3 appears in SCOP 1.65
  
• d1cgu_3 appears in the current release, SCOPe 2.08, called d1cgua3