SCOPe 2.06: Domain d4ywbc1: 4ywb C:9-259

Lineage for d4ywbc1 (4ywb C:9-259)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)

6. Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (40 PDB entries)

8. Domain d4ywbc1: 4ywb C:9-259 [277413]
   Other proteins in same PDB: d4ywba2, d4ywbc2
   automated match to d3dt2a1
   complexed with 1wd, cl, mn, na, oxd

Details for d4ywbc1

PDB Entry: 4ywb, 1.5 Å

PDB Description: structure of rat cytosolic pepck in complex with 3-mercaptopicolinic acid and oxalic acid

PDB Compounds: (C:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d4ywbc1:

Sequence; same for both SEQRES and ATOM records:

>d4ywbc1 c.109.1.1 (C:9-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqeegvirk
lkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfekafna
rfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlealgdge
fikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgkkcfal
riasrlakeeg

Timeline for d4ywbc1:

• d4ywbc1 first appeared in SCOPe 2.05
  
• d4ywbc1 appears in SCOPe 2.07
  
• d4ywbc1 appears in the current release, SCOPe 2.08