Lineage for d4yu4a_ (4yu4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717983Species Helogale parvula [TaxId:210647] [277372] (2 PDB entries)
  8. 1717986Domain d4yu4a_: 4yu4 A: [277375]
    automated match to d3lqda_
    complexed with hem, oxy

Details for d4yu4a_

PDB Entry: 4yu4 (more details), 2.8 Å

PDB Description: crystal structure of mongoose (helogale parvula) hemoglobin at ph 7.0
PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d4yu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yu4a_ a.1.1.2 (A:) automated matches {Helogale parvula [TaxId: 210647]}
vlspadktnikaswekigshggeygaealertflcfpttktyfphfdlshgsaqvkahgk
kvadaltnavghlddlpgalsalsdlhayklrvdpvnfkllshcllvtlashhpaeftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d4yu4a_:

Click to download the PDB-style file with coordinates for d4yu4a_.
(The format of our PDB-style files is described here.)

Timeline for d4yu4a_: