SCOPe 2.05: Domain d4wwqa_: 4wwq A:

Lineage for d4wwqa_ (4wwq A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 7 [103135] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103136] (4 PDB entries)

8. Domain d4wwqa_: 4wwq A: [277333]
   automated match to d1mw4a_
   complexed with mla

Details for d4wwqa_

PDB Entry: 4wwq, 1.8 Å

PDB Description: apo structure of the grb7 sh2 domain

PDB Compounds: (A:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d4wwqa_:

Sequence; same for both SEQRES and ATOM records:

>d4wwqa_ d.93.1.1 (A:) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]}
lsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchlqkvkhy
lilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

Timeline for d4wwqa_:

• d4wwqa_ is new in SCOPe 2.05-stable
  
• d4wwqa_ appears in SCOPe 2.06
  
• d4wwqa_ appears in the current release, SCOPe 2.08