Lineage for d3wyza_ (3wyz A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833668Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1833912Superfamily c.6.3: PHP domain-like [89550] (3 families) (S)
  5. 1833935Family c.6.3.0: automated matches [277008] (1 protein)
    not a true family
  6. 1833936Protein automated matches [277009] (1 species)
    not a true protein
  7. 1833937Species Thermococcus kodakarensis [TaxId:69014] [277010] (2 PDB entries)
  8. 1833938Domain d3wyza_: 3wyz A: [277013]
    automated match to d2czvb_
    complexed with gol

Details for d3wyza_

PDB Entry: 3wyz (more details), 2.21 Å

PDB Description: on archaeal homologs of the human rnase p protein rpp30 in the hyperthermophilic archaeon thermococcus kodakarensis
PDB Compounds: (A:) Ribonuclease P protein component 3

SCOPe Domain Sequences for d3wyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wyza_ c.6.3.0 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
fsrdyfvemdvrdeeahelasdwfdevvftkklvledppdwgslkeelkelrgkygkval
llvtrkpslirevksrnlkallyvqggdmrinrmaiesgvdalispwfgrkdpgfdhtla
gmaarrgvaigfslspllnanpygraqilrfmmktwqlvkkyrvprfitssaesrwevrg
prdlmslginigmeipearaslnfyprtivwk

SCOPe Domain Coordinates for d3wyza_:

Click to download the PDB-style file with coordinates for d3wyza_.
(The format of our PDB-style files is described here.)

Timeline for d3wyza_: