SCOPe 2.08: Domain d4re3a1: 4re3 A:1-478

Lineage for d4re3a1 (4re3 A:1-478)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Oryza sativa [TaxId:39946] [267953] (5 PDB entries)

8. Domain d4re3a1: 4re3 A:1-478 [276983]
   Other proteins in same PDB: d4re3a2
   automated match to d4jiea_
   complexed with epe, gim, gol, trs

Details for d4re3a1

PDB Entry: 4re3, 2.55 Å

PDB Description: different transition state conformations for the hydrolysis of beta- mannosides and beta-glucosides in the rice os7bglu26 family gh1 beta- mannosidase/beta-glucosidase

PDB Compounds: (A:) Beta-mannosidase/beta-glucosidase

SCOPe Domain Sequences for d4re3a1:

Sequence; same for both SEQRES and ATOM records:

>d4re3a1 c.1.8.0 (A:1-478) automated matches {Oryza sativa [TaxId: 39946]}
ywlnpeiydagglsrrafpegfvfgtaasayqvegmakqggrgpsiwdafiekpgtipnn
atadvtvdeyhrykedvnimknmgfdayrfsiswsrifpngtgmvnqegvdyynrlidym
vkkgikpyanlyhydlplalheqylgwlspniveafadyadfcfqtfgdrvkdwftfnep
rcvaalgydngfhapgrcsgcdaggnsttepylaahhlilshaaavkryrekyqlyqkgr
igilldfvwyepfsdsnadraaaqrardfhlgwfldpiihgrypysmleivkdrmptfsd
eesrmvkdsidyvginhytsfymkdpgpwnltptsyqddwhvgfayerngvpigaqansy
wlyivpwginkavtyvketygnptmilsengmdqpgnvsitqgvhdtvriryyrnyitel
kkaiddgakvigyfawslldnfewrlgytsrfgivyvdyktlkrypkdsafwfknmls

Timeline for d4re3a1:

• d4re3a1 first appeared in SCOPe 2.05, called d4re3a_
  
• d4re3a1 appears in SCOPe 2.07