Lineage for d5cvud2 (5cvu D:123-368)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145451Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 2145491Protein automated matches [226979] (2 species)
    not a true protein
  7. 2145492Species Clarkia breweri [TaxId:36903] [226318] (5 PDB entries)
  8. 2145506Domain d5cvud2: 5cvu D:123-368 [276906]
    Other proteins in same PDB: d5cvua1, d5cvub1, d5cvuc1, d5cvud1
    automated match to d1kyzc2
    complexed with 55b, no3, sah

Details for d5cvud2

PDB Entry: 5cvu (more details), 1.8 Å

PDB Description: sinpyl alcohol bound monolignol 4-o-methyltransferase 5
PDB Compounds: (D:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d5cvud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cvud2 c.66.1.12 (D:123-368) automated matches {Clarkia breweri [TaxId: 36903]}
dgvslapflllatdkvllepwfylkdaileggipfnkaygmniwdyfgtdhrinkvfnkg
mssnstitmkkilemyngfeglttivdvgggtgavasmivakypsinainfdlphviqda
pafsgvehlggdmfdgvpkgdaifikwichdwsdehclkllkncyaalpdhgkvivaeyi
lppspdpsiatkvvihtdalmlaynpggkertekefqalamasgfrgfkvascafntyvm
eflkta

SCOPe Domain Coordinates for d5cvud2:

Click to download the PDB-style file with coordinates for d5cvud2.
(The format of our PDB-style files is described here.)

Timeline for d5cvud2: