Lineage for d4wifa_ (4wif A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882436Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1882437Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1882645Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 1882646Protein automated matches [190746] (11 species)
    not a true protein
  7. 1882690Species Mycobacterium tuberculosis [TaxId:1773] [196473] (3 PDB entries)
  8. 1882694Domain d4wifa_: 4wif A: [276766]
    automated match to d1r5tc_
    complexed with zn; mutant

Details for d4wifa_

PDB Entry: 4wif (more details), 1.8 Å

PDB Description: crystal structure of e47q mutant cytidine deaminase from mycobacterium tuberculosis (mtcda e47q)
PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d4wifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wifa_ c.97.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvdwnmlrgnatqaaagayvpysrfavgaaalvddgrvvtgcnvqnvsygltlcaecavv
calhstgggrllalacvdghgsvlmpcgrcrqvllehggsellidhpvrprrlgdllpda
fg

SCOPe Domain Coordinates for d4wifa_:

Click to download the PDB-style file with coordinates for d4wifa_.
(The format of our PDB-style files is described here.)

Timeline for d4wifa_: