SCOPe 2.05: Domain d5dd4a2: 5dd4 A:150-225

Lineage for d5dd4a2 (5dd4 A:150-225)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [273876] (3 PDB entries)

8. Domain d5dd4a2: 5dd4 A:150-225 [276707]
   Other proteins in same PDB: d5dd4a1
   automated match to d2fb1a1
   complexed with act, edo

Details for d5dd4a2

PDB Entry: 5dd4, 2.56 Å

PDB Description: apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi

PDB Compounds: (A:) transcriptional regulator AraR

SCOPe Domain Sequences for d5dd4a2:

Sequence; same for both SEQRES and ATOM records:

>d5dd4a2 a.4.5.0 (A:150-225) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
pigfnllpklftlsqlqslyeaiygepmdkrnfrkrvaemdfiektdkidklgskrgaal
ykfngkayrkdpkfkl

Timeline for d5dd4a2:

• d5dd4a2 is new in SCOPe 2.05-stable
  
• d5dd4a2 appears in SCOPe 2.06
  
• d5dd4a2 appears in the current release, SCOPe 2.08