Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ran [52609] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52611] (43 PDB entries) |
Domain d5cj2h_: 5cj2 H: [276669] automated match to d2mmca_ complexed with gdp, mg, po4; mutant |
PDB Entry: 5cj2 (more details), 1.75 Å
SCOPe Domain Sequences for d5cj2h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cj2h_ c.37.1.8 (H:) Ran {Human (Homo sapiens) [TaxId: 9606]} qvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev vmdpalaaqyehdleva
Timeline for d5cj2h_: