Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries) |
Domain d5bxbg1: 5bxb G:29-131 [276509] Other proteins in same PDB: d5bxba2, d5bxbb2, d5bxbc2, d5bxbd2, d5bxbe2, d5bxbf2, d5bxbg2, d5bxbh2, d5bxbi2, d5bxbj2 automated match to d3kvta_ |
PDB Entry: 5bxb (more details), 2.17 Å
SCOPe Domain Sequences for d5bxbg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxbg1 d.42.1.0 (G:29-131) automated matches {Human (Homo sapiens) [TaxId: 9606]} napvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryil nflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdr
Timeline for d5bxbg1: