Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Myxococcus fulvus [TaxId:33] [276368] (1 PDB entry) |
Domain d4v2pb2: 4v2p B:186-335 [276370] automated match to d3gwaa2 complexed with cl, mpd, na, po4 |
PDB Entry: 4v2p (more details), 1.67 Å
SCOPe Domain Sequences for d4v2pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v2pb2 c.95.1.0 (B:186-335) automated matches {Myxococcus fulvus [TaxId: 33]} ihashlrtygfgaefsevrgggsrkppnskdtrpednylhmngaellkigfeylpkftes lwkqcpditvrdvkyiiphqpsrvvldylslsypeekliriierfgncigasmpmalyea vklrglqrgdkavltgtgsgvsfvgmvfty
Timeline for d4v2pb2: