Lineage for d4v0jb_ (4v0j B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729468Protein automated matches [190435] (9 species)
    not a true protein
  7. 1729469Species Castor bean (Ricinus communis) [TaxId:3988] [187330] (3 PDB entries)
  8. 1729480Domain d4v0jb_: 4v0j B: [276365]
    automated match to d2uw1b_
    complexed with fe2, gol; mutant

Details for d4v0jb_

PDB Entry: 4v0j (more details), 2.8 Å

PDB Description: the channel-block ser202glu, thr104lys double mutant of stearoyl-acp-desaturase from castor bean (ricinus communis)
PDB Compounds: (B:) acyl-[acyl-carrier-protein] desaturase, chloroplastic

SCOPe Domain Sequences for d4v0jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v0jb_ a.25.1.2 (B:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
ppqkieifksldnwaeenilvhlkpvekcwqpqdflpdpasdgfdeqvrelrerakeipd
dyfvvlvgdmikeealptyqtmlntldgvrdetgasptswaiwtrawtaeenrhgdllnk
ylylsgrvdmrqiektiqyligsgmdprtenspylgfiytsfqeratfiehgntarqake
hgdiklaqicgtiaadekrhetaytkiveklfeidpdgtvlafadmmrkkismpahlmyd
grddnlfdhfsavaqrlgvytakdyadileflvgrwkvdkltglsaegqkaqdyvcrlpp
rirrleeraqgrakeaptmpfswifdrqvkl

SCOPe Domain Coordinates for d4v0jb_:

Click to download the PDB-style file with coordinates for d4v0jb_.
(The format of our PDB-style files is described here.)

Timeline for d4v0jb_: