Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
Protein Sorcin [69023] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69024] (4 PDB entries) |
Domain d4u8db_: 4u8d B: [276362] automated match to d1juoa_ complexed with mg |
PDB Entry: 4u8d (more details), 2.3 Å
SCOPe Domain Sequences for d4u8db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4u8db_ a.39.1.8 (B:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} fpgqtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdm sgtmgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiak rystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv
Timeline for d4u8db_: