SCOPe 2.06: Domain d4u8db_: 4u8d B:

Lineage for d4u8db_ (4u8d B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Sorcin [69023] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69024] (4 PDB entries)

8. Domain d4u8db_: 4u8d B: [276362]
   automated match to d1juoa_
   complexed with mg

Details for d4u8db_

PDB Entry: 4u8d, 2.3 Å

PDB Description: x-ray structure of mg-bound human sorcin

PDB Compounds: (B:) sorcin

SCOPe Domain Sequences for d4u8db_:

Sequence; same for both SEQRES and ATOM records:

>d4u8db_ a.39.1.8 (B:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}
fpgqtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdm
sgtmgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiak
rystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv

Timeline for d4u8db_:

• d4u8db_ first appeared in SCOPe 2.05
  
• d4u8db_ appears in SCOPe 2.07
  
• d4u8db_ appears in the current release, SCOPe 2.08