SCOPe 2.05: Domain d4xb6f_: 4xb6 F:

Lineage for d4xb6f_ (4xb6 F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.2: PhnH-like [159709] (1 family)
   single domain protein of similar topology to the core domain of PLP-transferases
   automatically mapped to Pfam PF05845

5. Family c.67.2.1: PhnH-like [159710] (2 proteins)
   Pfam PF05845; Bacterial phosphonate metabolism protein (PhnH)

6. Protein automated matches [276189] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [276192] (1 PDB entry)

8. Domain d4xb6f_: 4xb6 F: [276194]
   automated match to d2fsua1
   complexed with so4, zn

Details for d4xb6f_

PDB Entry: 4xb6, 1.7 Å

PDB Description: structure of the e. coli c-p lyase core complex

PDB Compounds: (F:) Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnH

SCOPe Domain Sequences for d4xb6f_:

Sequence; same for both SEQRES and ATOM records:

>d4xb6f_ c.67.2.1 (F:) automated matches {Escherichia coli [TaxId: 511145]}
tletafmlpvqdaqhsfrrllkamsepgvivalhqlkrgwqplniattsvlltladndtp
vwlstplnndivnqslrfhtnaplvsqpeqatfavtdeaisseqlnalstgtavapeaga
tlilqvaslsggrmlrltgagiaeermiaprlpecilhelterphpfplgidliltcger
llaiprtthvevc

Timeline for d4xb6f_:

• d4xb6f_ is new in SCOPe 2.05-stable
  
• d4xb6f_ appears in SCOPe 2.06
  
• d4xb6f_ appears in the current release, SCOPe 2.08