SCOPe 2.06: Domain d1nsbb_: 1nsb B:

Lineage for d1nsbb_ (1nsb B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein Influenza neuraminidase [50943] (4 species)

7. Species Influenza B virus, different strains [TaxId:11520] [50945] (18 PDB entries)

8. Domain d1nsbb_: 1nsb B: [27598]
   complexed with ca, nag

Details for d1nsbb_

PDB Entry: 1nsb, 2.2 Å

PDB Description: the 2.2 angstroms resolution crystal structure of influenza b neuraminidase and its complex with sialic acid

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d1nsbb_:

Sequence; same for both SEQRES and ATOM records:

>d1nsbb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]}
epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthya
aqpggyyngtredrnklrhlisvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dsnalikikygeaytdtyhsyannilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtmsktermg
melyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkk
twhsaataiyclmgsgqllwdtvtgvdmal

Timeline for d1nsbb_:

• d1nsbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1nsbb_ appears in SCOPe 2.05
  
• d1nsbb_ appears in SCOPe 2.07
  
• d1nsbb_ appears in the current release, SCOPe 2.08