Lineage for d4r1qa2 (4r1q A:328-496)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062590Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) (S)
  5. 2062609Family b.43.2.0: automated matches [227252] (1 protein)
    not a true family
  6. 2062610Protein automated matches [227032] (4 species)
    not a true protein
  7. 2062615Species Geobacillus kaustophilus [TaxId:235909] [275932] (3 PDB entries)
  8. 2062616Domain d4r1qa2: 4r1q A:328-496 [275947]
    Other proteins in same PDB: d4r1qa1, d4r1qb1, d4r1qc1, d4r1qd1, d4r1qe1, d4r1qf1
    automated match to d2ajta1
    complexed with mn, sst

Details for d4r1qa2

PDB Entry: 4r1q (more details), 2.25 Å

PDB Description: crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase in complex with l-arabitol
PDB Compounds: (A:) L-arabinose isomerase

SCOPe Domain Sequences for d4r1qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r1qa2 b.43.2.0 (A:328-496) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tsfmedytyhfepgnelilgahmlevcptiaatrprvevhplsiggkedparlvfdggeg
aavnaslidlghrfrlivnevdavkpehdmpklpvarilwkprpslrdsaeawilaggah
htcfsfavtteqlqdfaemagiecvvinehtsvssfknelkwnevfwrg

SCOPe Domain Coordinates for d4r1qa2:

Click to download the PDB-style file with coordinates for d4r1qa2.
(The format of our PDB-style files is described here.)

Timeline for d4r1qa2: