Lineage for d1ncbn_ (1ncb N:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301738Fold b.68: 6-bladed beta-propeller [50938] (8 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 301739Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 301740Family b.68.1.1: Sialidases (neuraminidases) [50940] (7 proteins)
  6. 301741Protein Influenza neuraminidase [50943] (2 species)
  7. 301742Species Influenza A virus, different strains [TaxId:11320] [50944] (48 PDB entries)
  8. 301777Domain d1ncbn_: 1ncb N: [27573]
    Other proteins in same PDB: d1ncbh1, d1ncbh2, d1ncbl1, d1ncbl2
    complexed with ca, man, nag; mutant

Details for d1ncbn_

PDB Entry: 1ncb (more details), 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1ncbn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncbn_ b.68.1.1 (N:) Influenza neuraminidase {Influenza A virus, different strains}
irdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgtti
rgkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnn
nasaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfke
gkilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyics
pvltdnprpddptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvp
naltddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwt
snsivsmcssteflgqwdwpdgakieyfl

SCOP Domain Coordinates for d1ncbn_:

Click to download the PDB-style file with coordinates for d1ncbn_.
(The format of our PDB-style files is described here.)

Timeline for d1ncbn_: