SCOPe 2.05: Domain d5a3id2: 5a3i D:112-218

Lineage for d5a3id2 (5a3i D:112-218)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)
Domain d5a3id2: 5a3i D:112-218 [275170]
Other proteins in same PDB: d5a3ia_, d5a3ib_, d5a3id1, d5a3ie_, d5a3if_, d5a3ih1
automated match to d1dn0a2
complexed with nag; mutant

Details for d5a3id2

PDB Entry: 5a3i (more details), 2.89 Å

PDB Description: crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin

PDB Compounds: (D:) anti-haemagglutinin ha1 fab light chain

SCOPe Domain Sequences for d5a3id2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a3id2 b.1.1.2 (D:112-218) automated matches {Homo sapiens [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5a3id2:

Click to download the PDB-style file with coordinates for d5a3id2.
(The format of our PDB-style files is described here.)

Timeline for d5a3id2: