Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (31 species) not a true protein |
Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (4 PDB entries) |
Domain d4zu7c1: 4zu7 C:1-136 [275142] Other proteins in same PDB: d4zu7a2, d4zu7b2, d4zu7c2, d4zu7d2, d4zu7e2, d4zu7f2 automated match to d4o9ga_ complexed with pxn, tyd; mutant |
PDB Entry: 4zu7 (more details), 2.3 Å
SCOPe Domain Sequences for d4zu7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zu7c1 b.82.1.0 (C:1-136) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} mlynvalikfkdiadkrghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl iclngsvkirlkipdeekiielndpsvglyigplvwhemfdftegcvllvlaseyydetd yirnydfyideakkrf
Timeline for d4zu7c1: