Lineage for d4zu7c_ (4zu7 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807602Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 1807603Protein automated matches [190388] (20 species)
    not a true protein
  7. 1807770Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (3 PDB entries)
  8. 1807777Domain d4zu7c_: 4zu7 C: [275142]
    automated match to d4o9ga_
    complexed with pxn, tyd; mutant

Details for d4zu7c_

PDB Entry: 4zu7 (more details), 2.3 Å

PDB Description: x-ray structure if the qdta 3,4-ketoisomerase from thermoanaerobacterium thermosaccharolyticum, double mutant y17r/r97h, in complex with tdp
PDB Compounds: (C:) QdtA

SCOPe Domain Sequences for d4zu7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zu7c_ b.82.1.0 (C:) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]}
mlynvalikfkdiadkrghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
iclngsvkirlkipdeekiielndpsvglyigplvwhemfdftegcvllvlaseyydetd
yirnydfyideakkrfle

SCOPe Domain Coordinates for d4zu7c_:

Click to download the PDB-style file with coordinates for d4zu7c_.
(The format of our PDB-style files is described here.)

Timeline for d4zu7c_: