Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (20 species) not a true protein |
Species Thermoanaerobacterium thermosaccharolyticum [TaxId:1517] [238466] (3 PDB entries) |
Domain d4zu7c_: 4zu7 C: [275142] automated match to d4o9ga_ complexed with pxn, tyd; mutant |
PDB Entry: 4zu7 (more details), 2.3 Å
SCOPe Domain Sequences for d4zu7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zu7c_ b.82.1.0 (C:) automated matches {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} mlynvalikfkdiadkrghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl iclngsvkirlkipdeekiielndpsvglyigplvwhemfdftegcvllvlaseyydetd yirnydfyideakkrfle
Timeline for d4zu7c_: