SCOP 1.63: Domain d1c5fk_: 1c5f K:

Lineage for d1c5fk_ (1c5f K:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (8 species)

7. Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)

8. Domain d1c5fk_: 1c5f K: [27502]

Details for d1c5fk_

PDB Entry: 1c5f, 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a

SCOP Domain Sequences for d1c5fk_:

Sequence; same for both SEQRES and ATOM records:

>d1c5fk_ b.62.1.1 (K:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

Timeline for d1c5fk_:

• d1c5fk_ first appeared (with stable ids) in SCOP 1.55
  
• d1c5fk_ appears in SCOP 1.61
  
• d1c5fk_ appears in SCOP 1.65
  
• d1c5fk_ appears in the current release, SCOPe 2.08