Lineage for d3wqha2 (3wqh A:509-766)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152916Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)
  8. 2153079Domain d3wqha2: 3wqh A:509-766 [274986]
    Other proteins in same PDB: d3wqha1, d3wqhb1
    automated match to d4n8db2
    complexed with nag, skk

Details for d3wqha2

PDB Entry: 3wqh (more details), 2.85 Å

PDB Description: crystal structure of human dpp-iv in complex with anagliptin
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3wqha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wqha2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3wqha2:

Click to download the PDB-style file with coordinates for d3wqha2.
(The format of our PDB-style files is described here.)

Timeline for d3wqha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wqha1