Lineage for d4wp6a_ (4wp6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834946Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1834947Protein automated matches [190787] (10 species)
    not a true protein
  7. 1834951Species Chaetomium thermophilum [TaxId:759272] [274975] (1 PDB entry)
  8. 1834952Domain d4wp6a_: 4wp6 A: [274976]
    automated match to d1fo1b_

Details for d4wp6a_

PDB Entry: 4wp6 (more details), 1.7 Å

PDB Description: structure of the mex67 lrr domain from chaetomium thermophilum
PDB Compounds: (A:) mRNA export protein

SCOPe Domain Sequences for d4wp6a_:

Sequence, based on SEQRES records: (download)

>d4wp6a_ c.10.2.0 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
tkqkltsclarrynaeqklldlsalgtdetlsslgsfnnqslaeksfkalmhlvsneykd
peqkneaiqavslarndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfl
eelhltgnpvttlpnyateikkwfpslqildgqqirtpqeaaes

Sequence, based on observed residues (ATOM records): (download)

>d4wp6a_ c.10.2.0 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
tkqkltsclarrynaeqklldlsalgtdlaeksfkalmhlvsneykdpeqkneaiqavsl
arndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfleelhltgnpvttl
pnyateikkwfpslqildgqqirtpqeaaes

SCOPe Domain Coordinates for d4wp6a_:

Click to download the PDB-style file with coordinates for d4wp6a_.
(The format of our PDB-style files is described here.)

Timeline for d4wp6a_: