Lineage for d2rmcc_ (2rmc C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232982Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 232983Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 232984Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 232990Protein Cyclophilin (eukaryotic) [50893] (8 species)
  7. 233074Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)
  8. 233076Domain d2rmcc_: 2rmc C: [27492]

Details for d2rmcc_

PDB Entry: 2rmc (more details), 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a

SCOP Domain Sequences for d2rmcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmcc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

SCOP Domain Coordinates for d2rmcc_:

Click to download the PDB-style file with coordinates for d2rmcc_.
(The format of our PDB-style files is described here.)

Timeline for d2rmcc_: