Lineage for d3cysa_ (3cys A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801476Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1801477Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1801478Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1801479Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1801494Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (78 PDB entries)
    Uniprot P05092
  8. 1801622Domain d3cysa_: 3cys A: [27488]

Details for d3cysa_

PDB Entry: 3cys (more details)

PDB Description: determination of the nmr solution structure of the cyclophilin a- cyclosporin a complex
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d3cysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cysa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d3cysa_:

Click to download the PDB-style file with coordinates for d3cysa_.
(The format of our PDB-style files is described here.)

Timeline for d3cysa_: