SCOPe 2.02: Domain d1ocaa_: 1oca A:

Lineage for d1ocaa_ (1oca A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (57 PDB entries)
   Uniprot P05092

8. Domain d1ocaa_: 1oca A: [27487]

Details for d1ocaa_

PDB Entry: 1oca

PDB Description: human cyclophilin a, unligated, nmr, 20 structures

PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d1ocaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ocaa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1ocaa_:

• d1ocaa_ first appeared (with stable ids) in SCOP 1.55, called d1oca__
  
• d1ocaa_ appears in SCOPe 2.01
  
• d1ocaa_ appears in SCOPe 2.03
  
• d1ocaa_ appears in the current release, SCOPe 2.08