SCOP 1.61: Domain d1awve_: 1awv E:

Lineage for d1awve_ (1awv E:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)

4. Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (7 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)

8. Domain d1awve_: 1awv E: [27479]

Details for d1awve_

PDB Entry: 1awv, 2.34 Å

PDB Description: cypa complexed with hvgpia

SCOP Domain Sequences for d1awve_:

Sequence; same for both SEQRES and ATOM records:

>d1awve_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1awve_:

• d1awve_ first appeared (with stable ids) in SCOP 1.55
  
• d1awve_ appears in SCOP 1.59
  
• d1awve_ appears in SCOP 1.63
  
• d1awve_ appears in the current release, SCOPe 2.08