Lineage for d1awvc_ (1awv C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134137Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1134138Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1134139Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 1134140Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1134155Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (57 PDB entries)
    Uniprot P05092
  8. 1134259Domain d1awvc_: 1awv C: [27477]

Details for d1awvc_

PDB Entry: 1awv (more details), 2.34 Å

PDB Description: cypa complexed with hvgpia
PDB Compounds: (C:) cyclophilin a

SCOPe Domain Sequences for d1awvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awvc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1awvc_:

Click to download the PDB-style file with coordinates for d1awvc_.
(The format of our PDB-style files is described here.)

Timeline for d1awvc_: