SCOPe 2.05: Domain d5c4qa_: 5c4q A:

Lineage for d5c4qa_ (5c4q A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Leishmania donovani [TaxId:981087] [274710] (2 PDB entries)

8. Domain d5c4qa_: 5c4q A: [274711]
   automated match to d1n72a_
   complexed with bmf, unx

Details for d5c4qa_

PDB Entry: 5c4q, 1.93 Å

PDB Description: crystal structure analysis of bromodomain from leishmania donovani complexed with bromosporine

PDB Compounds: (A:) Bromodomain

SCOPe Domain Sequences for d5c4qa_:

Sequence; same for both SEQRES and ATOM records:

>d5c4qa_ a.29.2.0 (A:) automated matches {Leishmania donovani [TaxId: 981087]}
mdvskrpreefhkeqclsfvkklwaadtlamfhypvsatevpgyydvvdtpmdlstirkn
ieqgkyrtdtevendvvlmlsnaldfnekgsqwhdlakqlkkryltlaqesglsfdad

Timeline for d5c4qa_:

• d5c4qa_ is new in SCOPe 2.05-stable
  
• d5c4qa_ appears in SCOPe 2.06
  
• d5c4qa_ appears in the current release, SCOPe 2.08