SCOPe 2.07: Domain d4z17b1: 4z17 B:2-141

Lineage for d4z17b1 (4z17 B:2-141)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Chloroflexus aurantiacus [TaxId:324602] [274582] (3 PDB entries)

8. Domain d4z17b1: 4z17 B:2-141 [274596]
   Other proteins in same PDB: d4z17a2, d4z17b2
   automated match to d3qtpa1
   complexed with mg, pep

Details for d4z17b1

PDB Entry: 4z17, 2.65 Å

PDB Description: thermostable enolase from chloroflexus aurantiacus

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d4z17b1:

Sequence; same for both SEQRES and ATOM records:

>d4z17b1 d.54.1.0 (B:2-141) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}
stlieaivarevldsrgnptievdvrlesgdvgraivpsgastgahealelrdgdksryn
gkgvlkavqavnediaealigfdaadqialdqelialdgtpnksklganailgvslaaak
aaaaafglplyrylggvyah

Timeline for d4z17b1:

• d4z17b1 first appeared in SCOPe 2.05
  
• d4z17b1 appears in SCOPe 2.06
  
• d4z17b1 appears in the current release, SCOPe 2.08