Lineage for d4wdid2 (4wdi D:182-275)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370679Domain d4wdid2: 4wdi D:182-275 [274346]
    Other proteins in same PDB: d4wdia1, d4wdia3, d4wdib1, d4wdib2, d4wdid1, d4wdid3, d4wdie1, d4wdie2
    automated match to d1fo0h1
    complexed with edo, so4

Details for d4wdid2

PDB Entry: 4wdi (more details), 2.31 Å

PDB Description: weak tcr binding to an unstable insulin epitope drives type 1 diabetes
PDB Compounds: (D:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d4wdid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wdid2 b.1.1.0 (D:182-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrwk

SCOPe Domain Coordinates for d4wdid2:

Click to download the PDB-style file with coordinates for d4wdid2.
(The format of our PDB-style files is described here.)

Timeline for d4wdid2: