Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d4wdid2: 4wdi D:182-275 [274346] Other proteins in same PDB: d4wdia1, d4wdia3, d4wdib1, d4wdib2, d4wdid1, d4wdid3, d4wdie1, d4wdie2 automated match to d1fo0h1 complexed with edo, so4 |
PDB Entry: 4wdi (more details), 2.31 Å
SCOPe Domain Sequences for d4wdid2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wdid2 b.1.1.0 (D:182-275) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf qkwaavvvplgkeqnytchvhhkglpepltlrwk
Timeline for d4wdid2: