Lineage for d1cwma_ (1cwm A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62537Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 62538Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 62539Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 62545Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 62551Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)
  8. 62564Domain d1cwma_: 1cwm A: [27433]

Details for d1cwma_

PDB Entry: 1cwm (more details), 2 Å

PDB Description: human cyclophilin a complexed with 4 meile cyclosporin

SCOP Domain Sequences for d1cwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwma_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1cwma_:

Click to download the PDB-style file with coordinates for d1cwma_.
(The format of our PDB-style files is described here.)

Timeline for d1cwma_: