Lineage for d1cwma_ (1cwm A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) 
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (2 proteins) Protein Cyclophilin (eukaryotic) [50893] (7 species) Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries) 
Domain d1cwma_: 1cwm A: [27433]
Details for d1cwma_
PDB Entry: 1cwm (more details), 2 Å
PDB Description: human cyclophilin a complexed with 4 meile cyclosporin
SCOP Domain Sequences for d1cwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwma_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
SCOP Domain Coordinates for d1cwma_:
Click to download the PDB-style file with coordinates for d1cwma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cwma_:
- d1cwma_ appears in SCOP 1.57
- d1cwma_ appears in the current release, SCOPe 2.08
View in 3D