Lineage for d5bw2d_ (5bw2 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811015Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)
  8. 1811284Domain d5bw2d_: 5bw2 D: [274185]
    automated match to d3sioc_
    complexed with 4vu

Details for d5bw2d_

PDB Entry: 5bw2 (more details), 2.27 Å

PDB Description: x-ray crystal structure of aplysia californica acetylcholine binding protein (ac-achbp) y55w in complex with 2-pyridin-3-yl-1-aza- bicyclo[2.2.2]octane; 2-(3-pyridyl)quinuclidine; 2-pq (ti-4699)
PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5bw2d_:

Sequence, based on SEQRES records: (download)

>d5bw2d_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerra

Sequence, based on observed residues (ATOM records): (download)

>d5bw2d_ b.96.1.0 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnslm
wdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsfm
cdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrqvq
hysccpepyidvnlvvkfrerra

SCOPe Domain Coordinates for d5bw2d_:

Click to download the PDB-style file with coordinates for d5bw2d_.
(The format of our PDB-style files is described here.)

Timeline for d5bw2d_: