Lineage for d1swpa_ (1swp A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170128Fold b.61: Streptavidin-like [50875] (5 superfamilies)
  4. 170129Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 170130Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 170145Protein Streptavidin [50878] (1 species)
  7. 170146Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)
  8. 170329Domain d1swpa_: 1swp A: [27402]

Details for d1swpa_

PDB Entry: 1swp (more details), 2 Å

PDB Description: core-streptavidin mutant w120f in complex with biotin at ph 7.5

SCOP Domain Sequences for d1swpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1swpa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanafkstlvghdtftk

SCOP Domain Coordinates for d1swpa_:

Click to download the PDB-style file with coordinates for d1swpa_.
(The format of our PDB-style files is described here.)

Timeline for d1swpa_: