SCOPe 2.06: Domain d4ycwf1: 4ycw F:72-216

Lineage for d4ycwf1 (4ycw F:72-216)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (33 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (8 PDB entries)

8. Domain d4ycwf1: 4ycw F:72-216 [273820]
   Other proteins in same PDB: d4ycwa2, d4ycwb2, d4ycwe2, d4ycwf2
   automated match to d3bjua1
   protein/RNA complex; complexed with krs, lys; mutant

Details for d4ycwf1

PDB Entry: 4ycw, 2.9 Å

PDB Description: crystal structure of cladosporin in complex with plasmodium like human lysyl-trna synthetase mutant

PDB Compounds: (F:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4ycwf1:

Sequence; same for both SEQRES and ATOM records:

>d4ycwf1 b.40.4.0 (F:72-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvagr
ihakrasggklifydlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgkt
kkgelsiipyeitllspclhmlphl

Timeline for d4ycwf1:

• d4ycwf1 first appeared in SCOPe 2.05
  
• d4ycwf1 appears in SCOPe 2.07
  
• d4ycwf1 appears in the current release, SCOPe 2.08