Lineage for d4z7vb1 (4z7v B:3-92)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1898167Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1898168Protein automated matches [226842] (4 species)
    not a true protein
  7. 1898181Species Human (Homo sapiens) [TaxId:9606] [226044] (42 PDB entries)
  8. 1898246Domain d4z7vb1: 4z7v B:3-92 [273576]
    Other proteins in same PDB: d4z7va2, d4z7vb2, d4z7vc2, d4z7vd2, d4z7ve1, d4z7ve2, d4z7vf1, d4z7vf2, d4z7vg1, d4z7vg2, d4z7vh1, d4z7vh2
    automated match to d1klub2
    complexed with fuc, man, nag

Details for d4z7vb1

PDB Entry: 4z7v (more details), 2.65 Å

PDB Description: l3-12 complex
PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d4z7vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7vb1 d.19.1.0 (B:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeywn
sqkevlertraeldtvcrhnyqlelrttlq

SCOPe Domain Coordinates for d4z7vb1:

Click to download the PDB-style file with coordinates for d4z7vb1.
(The format of our PDB-style files is described here.)

Timeline for d4z7vb1: