Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d4z7wd2: 4z7w D:93-189 [273560] Other proteins in same PDB: d4z7wa1, d4z7wa2, d4z7wb1, d4z7wc1, d4z7wc2, d4z7wd1, d4z7we2, d4z7wf1, d4z7wf2, d4z7wg2, d4z7wh1, d4z7wh2 automated match to d1sebb1 complexed with fuc, man, nag, so4 |
PDB Entry: 4z7w (more details), 2.89 Å
SCOPe Domain Sequences for d4z7wd2:
Sequence, based on SEQRES records: (download)
>d4z7wd2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngd wtfqilvmlemtpqrgdvytchvehpslqnpiivewr
>d4z7wd2 b.1.1.0 (D:93-189) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispshnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtfqilv mlemtpqrgdvytchvehpslqnpiivewr
Timeline for d4z7wd2: