Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d4z7wc1: 4z7w C:1-81 [273543] Other proteins in same PDB: d4z7wa2, d4z7wb2, d4z7wc2, d4z7wd2, d4z7we1, d4z7we2, d4z7wf1, d4z7wf2, d4z7wg1, d4z7wg2, d4z7wh1, d4z7wh2 automated match to d1uvqa2 complexed with fuc, man, nag, so4 |
PDB Entry: 4z7w (more details), 2.89 Å
SCOPe Domain Sequences for d4z7wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z7wc1 d.19.1.0 (C:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa ltniavlkhnlnivikrsnsta
Timeline for d4z7wc1: