Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (6 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries) |
Domain d4xk9h1: 4xk9 H:1-208 [273491] Other proteins in same PDB: d4xk9a2, d4xk9b2, d4xk9c2, d4xk9e2, d4xk9f2, d4xk9h2, d4xk9i2, d4xk9j2 automated match to d3sioc_ complexed with 41j, cl |
PDB Entry: 4xk9 (more details), 2.2 Å
SCOPe Domain Sequences for d4xk9h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk9h1 b.96.1.0 (H:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerr
Timeline for d4xk9h1: