Lineage for d4xk9h1 (4xk9 H:1-208)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2085014Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2085015Protein automated matches [193506] (6 species)
    not a true protein
  7. 2085046Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)
  8. 2085294Domain d4xk9h1: 4xk9 H:1-208 [273491]
    Other proteins in same PDB: d4xk9a2, d4xk9b2, d4xk9c2, d4xk9e2, d4xk9f2, d4xk9h2, d4xk9i2, d4xk9j2
    automated match to d3sioc_
    complexed with 41j, cl

Details for d4xk9h1

PDB Entry: 4xk9 (more details), 2.2 Å

PDB Description: crystal structure of a-achbp in complex with pinnatoxin g
PDB Compounds: (H:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4xk9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk9h1 b.96.1.0 (H:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d4xk9h1:

Click to download the PDB-style file with coordinates for d4xk9h1.
(The format of our PDB-style files is described here.)

Timeline for d4xk9h1: