SCOP 1.59: Domain d2rtk__: 2rtk -

Lineage for d2rtk__ (2rtk -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.61: Streptavidin-like [50875] (4 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)

8. Domain d2rtk__: 2rtk - [27328]

Details for d2rtk__

PDB Entry: 2rtk, 1.82 Å

PDB Description: streptavidin-glycoluril complex, ph 2.58, space group i4122 prepared from an apostreptavidin crystal

SCOP Domain Sequences for d2rtk__:

Sequence; same for both SEQRES and ATOM records:

>d2rtk__ b.61.1.1 (-) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtk__:

• d2rtk__ first appeared (with stable ids) in SCOP 1.55
  
• d2rtk__ appears in SCOP 1.57
  
• d2rtk__ appears in SCOP 1.61
  
• d2rtk__ appears in the current release, SCOPe 2.08, called d2rtka_