PDB entry 2rtk

View 2rtk on RCSB PDB site
Description: streptavidin-glycoluril complex, ph 2.58, space group i4122 prepared from an apostreptavidin crystal
Deposited on 1997-09-11, released 1998-10-14
The last revision prior to the SCOP 1.59 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d2rtk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2rtk_ (-)
  aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
  lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
  vkp