Lineage for d4pnfd1 (4pnf D:3-87)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854859Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (6 PDB entries)
  8. 1854869Domain d4pnfd1: 4pnf D:3-87 [273127]
    Other proteins in same PDB: d4pnfa2, d4pnfb2, d4pnfc2, d4pnfd2, d4pnfe2, d4pnff2, d4pnfg2, d4pnfh2
    automated match to d4hi7b1
    complexed with gsh

Details for d4pnfd1

PDB Entry: 4pnf (more details), 2.11 Å

PDB Description: glutathione s-transferase from drosophila melanogaster - isozyme e6
PDB Compounds: (D:) RE21095p

SCOPe Domain Sequences for d4pnfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pnfd1 c.47.1.0 (D:3-87) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptleddg
hyiwdshaiiaylvskyadsdalyp

SCOPe Domain Coordinates for d4pnfd1:

Click to download the PDB-style file with coordinates for d4pnfd1.
(The format of our PDB-style files is described here.)

Timeline for d4pnfd1: