Lineage for d2izdd_ (2izd D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1800855Protein Streptavidin [50878] (1 species)
  7. 1800856Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)
  8. 1800979Domain d2izdd_: 2izd D: [27302]
    complexed with cl, iod, nh4, so4

Details for d2izdd_

PDB Entry: 2izd (more details), 1.6 Å

PDB Description: apostreptavidin ph 3.0 i222 complex
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d2izdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izdd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOPe Domain Coordinates for d2izdd_:

Click to download the PDB-style file with coordinates for d2izdd_.
(The format of our PDB-style files is described here.)

Timeline for d2izdd_: