Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.2: PDI-like [52849] (3 proteins) duplication: contains two tandem repeats of this fold |
Protein automated matches [254585] (1 species) not a true protein |
Species Fungus (Humicola insolens) [TaxId:34413] [255369] (4 PDB entries) |
Domain d2ruea1: 2rue A:6-121 [272979] Other proteins in same PDB: d2ruea2 automated match to d2kp1a_ |
PDB Entry: 2rue (more details)
SCOPe Domain Sequences for d2ruea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ruea1 c.47.1.2 (A:6-121) automated matches {Fungus (Humicola insolens) [TaxId: 34413]} egpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefkdrvvi akvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkykaa
Timeline for d2ruea1: