PDB entry 2rue

View 2rue on RCSB PDB site
Description: Solution structure of the a' domain of thermophilic fungal protein disulfide (oxidized form, 303K)
Class: isomerase
Keywords: thioredoxin fold, isomerase, disulfide bond, endoplasmic reticulum, redox-active center
Deposited on 2014-03-27, released 2015-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein disulfide-isomerase
    Species: Humicola insolens [TaxId:34413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55059 (5-120)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2ruea1, d2ruea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rueA (A:)
    gplgsegpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefk
    drvviakvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkyka
    a