Lineage for d4zo4c1 (4zo4 C:2-201)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479808Species Campylobacter jejuni [TaxId:192222] [189931] (3 PDB entries)
  8. 2479812Domain d4zo4c1: 4zo4 C:2-201 [272838]
    Other proteins in same PDB: d4zo4a2, d4zo4b2, d4zo4c2, d4zo4d2
    automated match to d4ttra_
    complexed with bme

Details for d4zo4c1

PDB Entry: 4zo4 (more details), 2.57 Å

PDB Description: dephospho-coa kinase from campylobacter jejuni.
PDB Compounds: (C:) dephospho-coa kinase

SCOPe Domain Sequences for d4zo4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zo4c1 c.37.1.0 (C:2-201) automated matches {Campylobacter jejuni [TaxId: 192222]}
knaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknllk
kekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplffes
gayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiikntns
yadfrqecvkviqeiskgnm

SCOPe Domain Coordinates for d4zo4c1:

Click to download the PDB-style file with coordinates for d4zo4c1.
(The format of our PDB-style files is described here.)

Timeline for d4zo4c1: