Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [189931] (2 PDB entries) |
Domain d4zo4c1: 4zo4 C:2-201 [272838] Other proteins in same PDB: d4zo4a2, d4zo4b2, d4zo4c2, d4zo4d2 automated match to d4ttra_ complexed with bme |
PDB Entry: 4zo4 (more details), 2.57 Å
SCOPe Domain Sequences for d4zo4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zo4c1 c.37.1.0 (C:2-201) automated matches {Campylobacter jejuni [TaxId: 192222]} knaffvtasiacgkstfieianslgfksisadkiahkildenalelekifspfslknllk kekkidrkilgeivfnnkeakkilenfthpkirakileqmqildkenkaffveiplffes gayenlgkviviytpkelslkrimqrdklsleaakarldsqidieeklkkadfiikntns yadfrqecvkviqeiskgnm
Timeline for d4zo4c1: