Lineage for d4yxwh1 (4yxw H:15-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428736Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 2428737Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 2428738Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)
  6. 2428759Protein automated matches [272490] (4 species)
    not a true protein
  7. 2428762Species Cow (Bos taurus) [TaxId:9913] [272491] (1 PDB entry)
  8. 2428763Domain d4yxwh1: 4yxw H:15-100 [272492]
    Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwa3, d4yxwb1, d4yxwb2, d4yxwb3, d4yxwc1, d4yxwc2, d4yxwc3, d4yxwd1, d4yxwd2, d4yxwd3, d4yxwe1, d4yxwe2, d4yxwe3, d4yxwf1, d4yxwf2, d4yxwf3, d4yxwh2, d4yxwi_
    automated match to d2v7qh2
    complexed with anp, cl, mg, na, ts6

Details for d4yxwh1

PDB Entry: 4yxw (more details), 3.1 Å

PDB Description: bovine heart mitochondrial f1-atpase inhibited by amp-pnp and adp in the presence of thiophosphate.
PDB Compounds: (H:) ATP synthase subunit delta, mitochondrial

SCOPe Domain Sequences for d4yxwh1:

Sequence, based on SEQRES records: (download)

>d4yxwh1 b.93.1.1 (H:15-100) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk
yfvssgsvtvnadssvqllaeeavtl

Sequence, based on observed residues (ATOM records): (download)

>d4yxwh1 b.93.1.1 (H:15-100) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvpvlrpglvvvhaedgttskyfv
ssgsvtvnadssvqllaeeavtl

SCOPe Domain Coordinates for d4yxwh1:

Click to download the PDB-style file with coordinates for d4yxwh1.
(The format of our PDB-style files is described here.)

Timeline for d4yxwh1: