Class b: All beta proteins [48724] (178 folds) |
Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) |
Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins) |
Protein automated matches [272490] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [272491] (1 PDB entry) |
Domain d4yxwh1: 4yxw H:15-100 [272492] Other proteins in same PDB: d4yxwa1, d4yxwa2, d4yxwa3, d4yxwb1, d4yxwb2, d4yxwb3, d4yxwc1, d4yxwc2, d4yxwc3, d4yxwd1, d4yxwd2, d4yxwd3, d4yxwe1, d4yxwe2, d4yxwe3, d4yxwf1, d4yxwf2, d4yxwf3, d4yxwh2, d4yxwi_ automated match to d2v7qh2 complexed with anp, cl, mg, na, ts6 |
PDB Entry: 4yxw (more details), 3.1 Å
SCOPe Domain Sequences for d4yxwh1:
Sequence, based on SEQRES records: (download)
>d4yxwh1 b.93.1.1 (H:15-100) automated matches {Cow (Bos taurus) [TaxId: 9913]} qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk yfvssgsvtvnadssvqllaeeavtl
>d4yxwh1 b.93.1.1 (H:15-100) automated matches {Cow (Bos taurus) [TaxId: 9913]} qmsftfasptqvffnsanvrqvdvptqtgafgilaahvpvlrpglvvvhaedgttskyfv ssgsvtvnadssvqllaeeavtl
Timeline for d4yxwh1: